HPA012802

BRWD3 antibody from Sigma-Aldrich
FLJ38568, MRX93
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012802
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012802, RRID:AB_2066662
Product name
Anti-BRWD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012802
Antibody type
Polyclonal
Antigen
Bromodomain and WD repeat-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQT
NDQDESILDGIIRELQREQDLRLINEGDVPHLPVN
RAYSVNGALRSPNMDISSSPNIRLRRHSSQIEGVR
QMHNNAPRSQMATERDLMAWSRRVVVNELNNGVSR
VQEE
Storage
-20C
Provider Type Product Number
- No reagents -