H00023741-B01P

EID1 antibody from Abnova Corporation
C15orf3, CRI1, EID-1

Antibody data

Product number
H00023741-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023741-B01P, RRID:AB_1137595
Product name
CRI1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00023741-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CRI1 protein.
Antigen sequence
MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGS
GSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPE
GKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDW
EDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTRE
PALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLT
EELGCDEIIDRE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -