H00002796-M11A

GNRH1 antibody from Abnova Corporation
GNRH, GRH, LHRH
No application information provided.

Antibody data

Product number
H00002796-M11A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002796-M11A, RRID:AB_1137239
Product name
GNRH1 monoclonal antibody (M11A), clone 1C2
Provider product page
Abnova Corporation - H00002796-M11A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GNRH1.
Antigen sequence
QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAET
QRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Isotype
IgM
Antibody clone number
1C2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -