HPA027532

GNRH1 antibody from Sigma-Aldrich
GNRH, GRH, LHRH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027532
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027532, RRID:AB_10612111
Product name
Anti-GNRH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027532
Antibody type
Polyclonal
Antigen
gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAET
QRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Storage
-20C
Provider Type Product Number
- No reagents -