HPA020352

METTL16 antibody from Sigma-Aldrich
METT10D, MGC3329
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020352
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020352, RRID:AB_1853828
Product name
Anti-METT10D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020352
Antibody type
Polyclonal
Antigen
Putative methyltransferase METT10D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DERSEEKGGVEVLESCQGSSNGAQDQEASEQFGSP
VAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMH
WVE
Storage
-20C
Provider Type Product Number
- No reagents -