HPA013335

INTS6L antibody from Sigma-Aldrich
DDX26B, FLJ41215
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013335
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013335, RRID:AB_1847553
Product name
Anti-DDX26B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013335
Antibody type
Polyclonal
Antigen
Protein DDX26B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DNLDCGLSYSVISYLKKLSQQTKLESERILASVGK
KPPQEIGIKVKNHSGGGMSLTHNKNFRKLLKEITG
ETALRLTELNTKEFAGFQIGLLNKDLKPQTYRNAY
DIPRRGLLDQLTRMRSNLLKTH
Storage
-20C
Provider Type Product Number
- No reagents -