HPA025038

NUGGC antibody from Sigma-Aldrich
C8orf80, HMFN0672, SLIP-GC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025038
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025038, RRID:AB_1845790
Product name
Anti-C8orf80 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025038
Antibody type
Polyclonal
Antigen
Uncharacterized protein C8orf80 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLQEGVRTARTSYRCILRACLVRSKGNQGFHQTLK
AVCLKNGIYASRTLARIDLNEALTQPVYDQIDPVF
GSIFRTGKPTGSALMP
Storage
-20C
Provider Type Product Number
- No reagents -