AV30058

ZMAT1 antibody from Sigma-Aldrich
KIAA1789
No application information provided.

Antibody data

Product number
AV30058
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV30058, RRID:AB_1859069
Product name
Anti-ZMAT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV30058
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZMAT1 with an internal ID of H00234
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQ
DELEDYIKVQKARGL
Storage
-20C
Provider Type Product Number
- No reagents -