HPA012827

ZMAT1 antibody from Sigma-Aldrich
KIAA1789
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012827
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012827, RRID:AB_1859070
Product name
Anti-ZMAT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012827
Antibody type
Polyclonal
Antigen
Zinc finger matrin-type protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSRKTQDSYQNECADYINVQKARGLEAKTCFRKME
ESSLETRRYREVVDSRPRHRMFEQRLPFETFRTYA
APYNISQAMEKQLPHSKKTYDSFQDELEDYIKVQK
ARGLDPKTCFRKMRENSVDTHGYREMVDSGP
Storage
-20C
Provider Type Product Number
- No reagents -