HPA012827

ZMAT1 antibody from Atlas Antibodies
KIAA1789
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012827
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012827, RRID:AB_1859070
Product name
Anti-ZMAT1
Provider product page
Atlas Antibodies - HPA012827
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NSRKTQDSYQNECADYINVQKARGLEAKTCFRKME
ESSLETRRYREVVDSRPRHRMFEQRLPFETFRTYA
APYNISQAMEKQLPHSKKTYDSFQDELEDYIKVQK
ARGLDPKTCFRKMRENSVDTHGYREMVDSGP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -