HPA025023

KIF13B antibody from Atlas Antibodies
GAKIN, KIAA0639
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025023
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025023, RRID:AB_1852471
Product name
Anti-KIF13B
Provider product page
Atlas Antibodies - HPA025023
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LTGKGKLSRRSISSPNVNRLSGSRQDLIPSYSLGS
NKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHS
PDPGLSNLAASYLNP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -