HPA025023

KIF13B antibody from Sigma-Aldrich
GAKIN, KIAA0639
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025023
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025023, RRID:AB_1852471
Product name
Anti-KIF13B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025023
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF13B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTGKGKLSRRSISSPNVNRLSGSRQDLIPSYSLGS
NKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHS
PDPGLSNLAASYLNP
Storage
-20C
Provider Type Product Number
- No reagents -