HPA056816

MIA3 antibody from Atlas Antibodies
FLJ39207, KIAA0268, TANGO, TANGO1, UNQ6077
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA056816
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA056816, RRID:AB_2683243
Product name
Anti-MIA3
Provider product page
Atlas Antibodies - HPA056816
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEET
ATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAE
LNVQVPEEPTHLDQRVI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -