Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010598-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010598-M01, RRID:AB_425858
- Product name
- AHSA1 monoclonal antibody (M01), clone 1A2-A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant AHSA1.
- Antigen sequence
MAKWGEGDPRWIVEERANATNVNNWHWTERDASNW
STDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASI
NNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEI
PNLSGENSVDEVEISVSLAKDEPDTNLVALMKEEG
VKLLREAMGIYISTLKTEFTQGMILPTMNGESVDP
VGQPALKTEERKAKPAPSKTQARPVGVKIPTCKIT
LKETFLTSPEELYRVFTTQELVQAFTHAPATLEAD
RGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWP
EGHFATITLTFIDKNGETELCMEGRGIPAPEEERT
RQGWQRYYFEGIKQTFGYGARLF- Isotype
- IgG
- Antibody clone number
- 1A2-A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Δ9-THC increases endogenous AHA1 expression in rat cerebellum and may modulate CB1 receptor function during chronic use.
High-content functional screen to identify proteins that correct F508del-CFTR function.
Characterizing the role of Hsp90 in production of heat shock proteins in motor neurons reveals a suppressive effect of wild-type Hsf1.
Filipeanu CM, Guidry JJ, Leonard ST, Winsauer PJ
Journal of neurochemistry 2011 Sep;118(6):1101-12
Journal of neurochemistry 2011 Sep;118(6):1101-12
High-content functional screen to identify proteins that correct F508del-CFTR function.
Trzcinska-Daneluti AM, Ly D, Huynh L, Jiang C, Fladd C, Rotin D
Molecular & cellular proteomics : MCP 2009 Apr;8(4):780-90
Molecular & cellular proteomics : MCP 2009 Apr;8(4):780-90
Characterizing the role of Hsp90 in production of heat shock proteins in motor neurons reveals a suppressive effect of wild-type Hsf1.
Taylor DM, Tradewell ML, Minotti S, Durham HD
Cell stress & chaperones 2007 Summer;12(2):151-62
Cell stress & chaperones 2007 Summer;12(2):151-62
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AHSA1 monoclonal antibody (M01), clone 1A2-A8 Western Blot analysis of AHSA1 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AHSA1 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol