HPA000903

AHSA1 antibody from Atlas Antibodies
Aha1, C14orf3, p38
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000903
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000903, RRID:AB_611287
Product name
Anti-AHSA1
Provider product page
Atlas Antibodies - HPA000903
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PTMNGESVDPVGQPALKTEERKAKPAPSKTQARPV
GVKIPTCKITLKETFLTSPEELYRVFTTQELVQAF
THAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHI
VMKWRFKSWPEGHFATITLTFIDKNGETELCMEGR
GIPAPEEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -