HPA000903

AHSA1 antibody from Sigma-Aldrich
Aha1, C14orf3, p38
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000903
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000903, RRID:AB_1078112
Product name
Anti-AHSA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000903
Antibody type
Polyclonal
Antigen
Activator of 90 kDa heat shock protein ATPase homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTMNGESVDPVGQPALKTEERKAKPAPSKTQARPV
GVKIPTCKITLKETFLTSPEELYRVFTTQELVQAF
THAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHI
VMKWRFKSWPEGHFATITLTFIDKNGETELCMEGR
GIPAPEEE
Storage
-20C
Provider Type Product Number
- No reagents -