HPA018886

BEX3 antibody from Atlas Antibodies
Bex, DXS6984E, HGR74, NADE, NGFRAP1

Antibody data

Product number
HPA018886
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018886, RRID:AB_1854453
Product name
Anti-BEX3
Provider product page
Atlas Antibodies - HPA018886
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARR
LAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREI
RRKLRELQLRNCLRILMGELSNHHDHHDEF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.