PAB29374

ZNF81 antibody from Abnova Corporation
HFZ20, MRX45

Antibody data

Product number
PAB29374
Provider
Abnova Corporation
Product name
ZNF81 polyclonal antibody
Provider product page
Abnova Corporation - PAB29374
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant human ZNF81.
Antigen sequence
VHPSPNLILSQKRPHKRDSFGKSFKHNLDLHIHNK
SNAAKNLDKTIGHGQVFTQNSSYSHHENTHTGVKF
CERNQCGKVLSLKHSLSQNVKFPIGEKANTCT
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -