Antibody data

Product number
H00347344-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00347344-M07, RRID:AB_1137558
Product name
ZNF81 monoclonal antibody (M07), clone 3G3
Provider product page
Abnova Corporation - H00347344-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF81.
Antigen sequence
MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEW
QQLDSTQRRLYQDVMLENYSHLLSVGFEVPKPEVI
FKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRI
SGKSTFHSEMEGEDTLC
Isotype
IgG
Antibody clone number
3G3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -