HPA001689

ZNF81 antibody from Atlas Antibodies
HFZ20, MRX45
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001689
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001689, RRID:AB_2666416
Product name
Anti-ZNF81
Provider product page
Atlas Antibodies - HPA001689
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VHPSPNLILSQKRPHKRDSFGKSFKHNLDLHIHNK
SNAAKNLDKTIGHGQVFTQNSSYSHHENTHTGVKF
CERNQCGKVLSLKHSLSQNVKFPIGEKANTCT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -