AV31985

ZNF81 antibody from Sigma-Aldrich
HFZ20, MRX45
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV31985
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV31985, RRID:AB_1859461
Product name
Anti-ZNF81 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV31985
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF81 with an internal ID of P02882.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGD
KPYKCSDCGKGFTQK
Storage
-20C
Provider Type Product Number
- No reagents -