Antibody data

Product number
ABIN501571
Provider
antibodies-online
Product name
anti-Gap Junction Protein, beta 1, 32kDa (GJB1) antibody
Provider product page
antibodies-online - ABIN501571
Antibody type
Polyclonal
Antigen
The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the middle region of human GJB1
Reactivity
Human, Mouse, Rat, Bovine, Canine, Rabbit
Host
Rabbit
Antigen sequence
RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEIN
KLLSE QDGSLKDILR
Vial size
50 µg
Provider Type Product Number
- No reagents -