Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010663 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-GJB1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINK
LLSEQDGSLKDILRRSPGTGAGLAEKSDRCSA- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Consistent and reproducible cultures of large-scale 3D mammary epithelial structures using an accessible bioprinting platform
Correlations of Differentially Expressed Gap Junction Connexins Cx26, Cx30, Cx32, Cx43 and Cx46 with Breast Cancer Progression and Prognosis
The potential prognostic value of connexin 26 and 46 expression in neoadjuvant-treated breast cancer
Reid J, Mollica P, Bruno R, Sachs P
Breast Cancer Research 2018;20(1)
Breast Cancer Research 2018;20(1)
Correlations of Differentially Expressed Gap Junction Connexins Cx26, Cx30, Cx32, Cx43 and Cx46 with Breast Cancer Progression and Prognosis
Scemes E, Teleki I, Szasz A, Maros M, Gyorffy B, Kulka J, Meggyeshazi N, Kiszner G, Balla P, Samu A, Krenacs T
PLoS ONE 2014;9(11):e112541
PLoS ONE 2014;9(11):e112541
The potential prognostic value of connexin 26 and 46 expression in neoadjuvant-treated breast cancer
Teleki I, Krenacs T, Szasz M, Kulka J, Wichmann B, Leo C, Papassotiropoulos B, Riemenschnitter C, Moch H, Varga Z
BMC Cancer 2013;13(1)
BMC Cancer 2013;13(1)
No comments: Submit comment
No validations: Submit validation data