HPA010663

GJB1 antibody from Sigma-Aldrich
CMTX, CMTX1, CX32
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010663
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010663, RRID:AB_1847139
Product name
Anti-GJB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010663
Antibody type
Polyclonal
Antigen
Gap junction beta-1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINK
LLSEQDGSLKDILRRSPGTGAGLAEKSDRCSA
Storage
-20C
Provider Type Product Number
- No reagents -