Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004534-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004534-M01, RRID:AB_463947
- Product name
- MTM1 monoclonal antibody (M01), clone 1C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MTM1.
- Antigen sequence
MASASTSKYNSHSLENESIKRTSRDGVNRDLTEAV
PRLPGETLITDKEVIYICPFNGPIKGRVYITNYRL
YLRSLETDSSLILDVPLGVISRIEKMGGAT- Isotype
- IgG
- Antibody clone number
- 1C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Myopathy in a woman and her daughter associated with a novel splice site MTM1 mutation.
Hedberg C, Lindberg C, Máthé G, Moslemi AR, Oldfors A
Neuromuscular disorders : NMD 2012 Mar;22(3):244-51
Neuromuscular disorders : NMD 2012 Mar;22(3):244-51
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MTM1 expression in transfected 293T cell line by MTM1 monoclonal antibody (M01), clone 1C10.Lane 1: MTM1 transfected lysate(69.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MTM1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MTM1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol