HPA010008

MTM1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010008
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010008, RRID:AB_1079426
Product name
Anti-MTM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010008
Antibody type
Polyclonal
Antigen
Myotubularin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCY
ELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPV
LSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLD
VIRETNKQISKLTIYDARPSVNAVANK
Storage
-20C
Provider Type Product Number
- No reagents -