Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009630-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009630-M06, RRID:AB_10551722
- Product name
- GNA14 monoclonal antibody (M06), clone 2H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GNA14.
- Antigen sequence
SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTG
IIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESV
TSIIFLVALSEYDQVLAECDNENRMEESKAL- Isotype
- IgG
- Antibody clone number
- 2H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GNA14 expression in transfected 293T cell line by GNA14 monoclonal antibody (M06), clone 2H8.Lane 1: GNA14 transfected lysate(41.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GNA14 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to GNA14 on formalin-fixed paraffin-embedded human breast. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol