HPA022148

RAP1GAP2 antibody from Sigma-Aldrich
GARNL4, KIAA1039
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022148
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022148, RRID:AB_1849474
Product name
Anti-GARNL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022148
Antibody type
Polyclonal
Antigen
Rap1 GTPase-activating protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSS
DATLPDRPLSPPLTAPPTMKSSEFFEMLEKMQGIK
LEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVI
Storage
-20C
Provider Type Product Number
- No reagents -