HPA015632

C1GALT1C1 antibody from Sigma-Aldrich
C1GALT2, COSMC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015632
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015632, RRID:AB_1845625
Product name
Anti-C1GALT1C1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015632
Antibody type
Polyclonal
Antigen
C1GALT1-specific chaperone 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NRMHHHEHHHLQAPNKEDILKISEDERMELSKSFR
VYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSE
NVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYN
WFFLARPTTFAIIE
Storage
-20C
Provider Type Product Number
- No reagents -