H00054984-A01

antibody from Abnova Corporation

Targeting: PINX1 FLJ20565, Gno1, LPTL, LPTS, MGC8850, Pxr1

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

H00054984-A01

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00054984-A01, RRID:AB_529882

Product name

PINX1 polyclonal antibody (A01)

Antibody type

Polyclonal

Description

Mouse polyclonal antibody raised against a partial recombinant PINX1.

Antigen sequence

MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLE
KMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGAT
INNEDNWIAHQDDFNQLLAELNTCHGQETT


Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Submitted references

The effects of telomere shortening on cancer cells: a network model of proteomic and microRNA analysis.

Uziel O, Yosef N, Sharan R, Ruppin E, Kupiec M, Kushnir M, Beery E, Cohen-Diker T, Nordenberg J, Lahav M
Genomics 2015 Jan;105(1):5-16

---

Plk1-mediated mitotic phosphorylation of PinX1 regulates its stability.

Wang C, Yu J, Yuan K, Lan J, Jin C, Huang H
European journal of cell biology 2010 Oct;89(10):748-56

---

The correlation of genetic instability of PINX1 gene to clinico-pathological features of gastric cancer in the Chinese population.

Ma Y, Wu L, Liu C, Xu L, Li D, Li JC
Journal of cancer research and clinical oncology 2009 Mar;135(3):431-7

---

PinX1 is recruited to the mitotic chromosome periphery by Nucleolin and facilitates chromosome congression.

Li N, Yuan K, Yan F, Huo Y, Zhu T, Liu X, Guo Z, Yao X
Biochemical and biophysical research communications 2009 Jun 19;384(1):76-81

Western blot

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

PINX1 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of PINX1 expression in IMR-32 ( Cat # L008V1 ).