H00054984-A01
antibody from Abnova Corporation
Targeting: PINX1
FLJ20565, Gno1, LPTL, LPTS, MGC8850, Pxr1
Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054984-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054984-A01, RRID:AB_529882
- Product name
- PINX1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PINX1.
- Antigen sequence
MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLE
KMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGAT
INNEDNWIAHQDDFNQLLAELNTCHGQETT- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The effects of telomere shortening on cancer cells: a network model of proteomic and microRNA analysis.
Plk1-mediated mitotic phosphorylation of PinX1 regulates its stability.
The correlation of genetic instability of PINX1 gene to clinico-pathological features of gastric cancer in the Chinese population.
PinX1 is recruited to the mitotic chromosome periphery by Nucleolin and facilitates chromosome congression.
Uziel O, Yosef N, Sharan R, Ruppin E, Kupiec M, Kushnir M, Beery E, Cohen-Diker T, Nordenberg J, Lahav M
Genomics 2015 Jan;105(1):5-16
Genomics 2015 Jan;105(1):5-16
Plk1-mediated mitotic phosphorylation of PinX1 regulates its stability.
Wang C, Yu J, Yuan K, Lan J, Jin C, Huang H
European journal of cell biology 2010 Oct;89(10):748-56
European journal of cell biology 2010 Oct;89(10):748-56
The correlation of genetic instability of PINX1 gene to clinico-pathological features of gastric cancer in the Chinese population.
Ma Y, Wu L, Liu C, Xu L, Li D, Li JC
Journal of cancer research and clinical oncology 2009 Mar;135(3):431-7
Journal of cancer research and clinical oncology 2009 Mar;135(3):431-7
PinX1 is recruited to the mitotic chromosome periphery by Nucleolin and facilitates chromosome congression.
Li N, Yuan K, Yan F, Huo Y, Zhu T, Liu X, Guo Z, Yao X
Biochemical and biophysical research communications 2009 Jun 19;384(1):76-81
Biochemical and biophysical research communications 2009 Jun 19;384(1):76-81
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PINX1 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of PINX1 expression in IMR-32 ( Cat # L008V1 ).