HPA019823

FAM20C antibody from Atlas Antibodies
DKFZp547D065, DMP4, G-CK, IMAGE:4942737
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019823
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019823, RRID:AB_1848389
Product name
Anti-FAM20C
Provider product page
Atlas Antibodies - HPA019823
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAV
DSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSS
QRITSVAMKSGGTQLKLIM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -