ABIN634926
antibody from antibodies-online
Targeting: FAM20C
DKFZp547D065, DMP4, G-CK, IMAGE:4942737
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN634926 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Family with Sequence Similarity 20, Member C (FAM20C) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- FAM20 C antibody was raised using the C terminal of FAM20 corresponding to a region with amino acids NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY
- Description
- Affinity purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
No comments: Submit comment
No validations: Submit validation data