ABIN487229
antibody from antibodies-online
Targeting: FAM20C
DKFZp547D065, DMP4, G-CK, IMAGE:4942737
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487229 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Family with Sequence Similarity 20, Member C (FAM20C) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FAM20°C antibody: synthetic peptide directed towards the C terminal of human FAM20°C
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIR
KSTYL RLQLLAKEEY- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine syndrome), highlighting a crucial molecule in bone development.
Simpson MA, Hsu R, Keir LS, Hao J, Sivapalan G, Ernst LM, Zackai EH, Al-Gazali LI, Hulskamp G, Kingston HM, Prescott TE, Ion A, Patton MA, Murday V, George A, Crosby AH
American journal of human genetics 2007 Nov;81(5):906-12
American journal of human genetics 2007 Nov;81(5):906-12
No comments: Submit comment
No validations: Submit validation data