HPA019823

FAM20C antibody from MilliporeSigma / Merck KGaA
DKFZp547D065, DMP4, G-CK, IMAGE:4942737
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019823
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019823, RRID:AB_1848389
Product name
Anti-FAM20C antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019823
Antibody type
Polyclonal
Antigen
Dentin matrix protein 4 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAV
DSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSS
QRITSVAMKSGGTQLKLIM
Storage
-20C
Provider Type Product Number
- No reagents -