Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00025831-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00025831-M03, RRID:AB_581849
- Product name
- HECTD1 monoclonal antibody (M03), clone 1E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HECTD1.
- Antigen sequence
DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLM
SDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLE
VTARAITYYLDVSAECTRRIVGVDGAIKALCNRLV
VVE- Isotype
- IgG
- Antibody clone number
- 1E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hectd1 regulates intracellular localization and secretion of Hsp90 to control cellular behavior of the cranial mesenchyme.
Sarkar AA, Zohn IE
The Journal of cell biology 2012 Mar 19;196(6):789-800
The Journal of cell biology 2012 Mar 19;196(6):789-800
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HECTD1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol