HPA002929

HECTD1 antibody from Sigma-Aldrich
KIAA1131
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002929
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002929, RRID:AB_1850574
Product name
Anti-HECTD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002929
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase HECTD1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKS
GLNQGAISTLQSSDILNLTKEQPQAKAGNGQNSCG
VEDVLQLLRILYIVASDPYSRISQEDGDEQPQFTF
PPDE
Storage
-20C
Provider Type Product Number
- No reagents -