Antibody data

Product number
PAB27465
Provider
Abnova Corporation
Product name
GLOD5 polyclonal antibody
Provider product page
Abnova Corporation - PAB27465
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant GLOD5.
Antigen sequence
RRLDHIVMTVKSIKDTTMFYSKILGMEVMTFKEDR
KALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICL
ITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIM
SIYFRDPDRNLIEVSNY
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -