HPA010667

GLOD5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010667
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010667, RRID:AB_1078975
Product name
Anti-GLOD5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010667
Antibody type
Polyclonal
Antigen
glyoxalase domain containing 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRLDHIVMTVKSIKDTTMFYSKILGMEVMTFKEDR
KALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICL
ITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIM
SIYFRDPDRNLIEVSNY
Storage
-20C
Provider Type Product Number
- No reagents -