Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311687 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Hydroxymethylbilane Synthase (HMBS) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HMBS antibody: synthetic peptide directed towards the N terminal of human HMBS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFE
IIAMS TTGDKILDTA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Acute intermittent porphyria with peripheral neuropathy: a follow-up study after hematin treatment.
Myelination of brain in experimental hypothyroidism. An electron-microscopic and biochemical study of purified myelin isolates.
Kuo HC, Lee MJ, Chuang WL, Huang CC
Journal of the neurological sciences 2007 Sep 15;260(1-2):231-5
Journal of the neurological sciences 2007 Sep 15;260(1-2):231-5
Myelination of brain in experimental hypothyroidism. An electron-microscopic and biochemical study of purified myelin isolates.
Malone MJ, Rosman NP, Szoke M, Davis D
Journal of the neurological sciences 1975 Sep;26(1):1-11
Journal of the neurological sciences 1975 Sep;26(1):1-11
No comments: Submit comment
No validations: Submit validation data