Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010668 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010668, RRID:AB_1849294
- Product name
- Anti-GPR34
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQN
FSATPNVTTCPMDE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references t(X;14)(p11.4;q32.33) is recurrent in marginal zone lymphoma and up-regulates GPR34
Baens M, Finalet Ferreiro J, Tousseyn T, Urbankova H, Michaux L, de Leval L, Dierickx D, Wolter P, Sagaert X, Vandenberghe P, De Wolf-Peeters C, Wlodarska I
Haematologica 2012 January;97(2):184-188
Haematologica 2012 January;97(2):184-188
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN