HPA010668

GPR34 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010668
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA010668, RRID:AB_1849294
Product name
Anti-GPR34 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA010668
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 34 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQN
FSATPNVTTCPMDE
Storage
-20C
Provider Type Product Number
- No reagents -