Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007442-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007442-M01, RRID:AB_489987
- Product name
- TRPV1 monoclonal antibody (M01), clone 1F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRPV1.
- Antigen sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDS
EEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDG
PTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ- Isotype
- IgG
- Antibody clone number
- 1F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human odontoblasts express functional thermo-sensitive TRP channels: implications for dentin sensitivity.
Endogenous expression of TRPV1 channel in cultured human melanocytes.
El Karim IA, Linden GJ, Curtis TM, About I, McGahon MK, Irwin CR, Lundy FT
Pain 2011 Oct;152(10):2211-23
Pain 2011 Oct;152(10):2211-23
Endogenous expression of TRPV1 channel in cultured human melanocytes.
Choi TY, Park SY, Jo JY, Kang G, Park JB, Kim JG, Hong SG, Kim CD, Lee JH, Yoon TJ
Journal of dermatological science 2009 Nov;56(2):128-30
Journal of dermatological science 2009 Nov;56(2):128-30
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TRPV1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol