Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007442-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007442-M02, RRID:AB_10718923
- Product name
- TRPV1 monoclonal antibody (M02), clone 1A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRPV1.
- Antigen sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDS
EEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDG
PTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ- Isotype
- IgG
- Antibody clone number
- 1A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The molecular pathway of ATP-sensitive potassium channel in endothelial cells for mediating arteriole relaxation.
Nerve growth factor rescues diabetic mice heart after ischemia/reperfusion injury via up-regulation of the TRPV1 receptor.
Chen X, Han W, Zhang Y, Cui W, Pan Z, Jin X, Long C, Wang H
Life sciences 2015 Sep 15;137:164-9
Life sciences 2015 Sep 15;137:164-9
Nerve growth factor rescues diabetic mice heart after ischemia/reperfusion injury via up-regulation of the TRPV1 receptor.
Zheng LR, Zhang YY, Han J, Sun ZW, Zhou SX, Zhao WT, Wang LH
Journal of diabetes and its complications 2015 Apr;29(3):323-8
Journal of diabetes and its complications 2015 Apr;29(3):323-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TRPV1 monoclonal antibody (M02), clone 1A8. Western Blot analysis of TRPV1 expression in rat thymus.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TRPV1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol