HPA020247

IFT74 antibody from Sigma-Aldrich
CCDC2, CMG-1, CMG1, FLJ22621
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020247
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020247, RRID:AB_1846140
Product name
Anti-IFT74 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020247
Antibody type
Polyclonal
Antigen
Intraflagellar transport protein 74 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELQGQLADYNMLVDKLNTNTEMEEVMNDYNMLKAQ
NDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQA
TDDIIKNMSFENQVKYLEMKTTNEKLLQE
Storage
-20C
Provider Type Product Number
- No reagents -