HPA011284

FMR1NB antibody from Atlas Antibodies
CT37, FLJ25736, NY-SAR-35
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011284
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011284, RRID:AB_1078898
Product name
Anti-FMR1NB
Provider product page
Atlas Antibodies - HPA011284
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLANGHILPNSENAHGQSLEEDSALEALLNFFFPT
TCNLRENQVAKPCNELQDLSESECLRHKCCFSSSG
TTSFKCFAPFRDVPKQMMQM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -