HPA011284

FMR1NB antibody from Sigma-Aldrich
CT37, FLJ25736, NY-SAR-35
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011284
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011284, RRID:AB_1078898
Product name
Anti-FMR1NB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011284
Antibody type
Polyclonal
Antigen
Fragile X mental retardation 1 neighbor protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLANGHILPNSENAHGQSLEEDSALEALLNFFFPT
TCNLRENQVAKPCNELQDLSESECLRHKCCFSSSG
TTSFKCFAPFRDVPKQMMQM
Storage
-20C
Provider Type Product Number
- No reagents -