Antibody data

Product number
PAB20163
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20163, RRID:AB_10961835
Product name
TTC28 polyclonal antibody
Provider product page
Abnova Corporation - PAB20163
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human TTC28.
Reactivity
Human
Host
Rabbit
Antigen sequence
IPLFGADTIGQRSPDGPVLSKAEFVEKVRQSNQAC
HDGDFHTAIVLYNEALAVDPQNCILYSNRSAAYMK
IQQYDKALDDAIKARLLNPKWPK
Isotype
IgG
Vial size
100 µl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -