HPA001378

PNN antibody from Sigma-Aldrich
memA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001378
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001378, RRID:AB_1079648
Product name
Anti-PNN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001378
Antibody type
Polyclonal
Antigen
Pinin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYI
PGRMCPATQKLIEESQRKMNALFEGRRIEFAEQIN
KMEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQ
REEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDA
EKE
Storage
-20C
Provider Type Product Number
- No reagents -