HPA012769

BEND2 antibody from MilliporeSigma / Merck KGaA
CXorf20, MGC33653
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012769
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-BEND2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA012769
Antibody type
Polyclonal
Antigen
BEN domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DQDDASASACLTPDFALLPLNILVKVDTNTENSVN
TMNRSTLLDSDSGQDSSSSSVCIPPKYGYLGDPKR
NVRVLKIHLLAVQNMAKPKQAACYLVRILFSKEIL
ISSSVDIHLKDSQSLDPNKMAALREYLATTFPTCD
LHEHG
Storage
-20C