HPA021658

INTS1 antibody from Atlas Antibodies
DKFZp586J0619, INT1, KIAA1440, NET28
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021658
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021658, RRID:AB_1852402
Product name
Anti-INTS1
Provider product page
Atlas Antibodies - HPA021658
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAE
SVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTC
GYKEVRLLAVQKLEMWLQNPK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -